DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33914

DIOPT Version :10

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:183 Identity:39/183 - (21%)
Similarity:73/183 - (39%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTNHICLKCEERSFRIKM-------------NEFAVKYKM-RDLIQHID--FRIVNLNNRSYVNG 63
            |||   :.||.:...:.:             |..:::|.| :.:..:|:  |:::...:.|    
  Fly    28 FTN---VTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSES---- 85

  Fly    64 EMIVKSDVEDILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNL 128
                        :|...: |:..      |:..:||.|:|.| :|.|.|.::..:....|.:.|.
  Fly    86 ------------IHAASN-WQPF------LHTMKLDLCRFWK-NHHNHLARMVFEFIDGHTNMNH 130

  Fly   129 SCPLRTNFNY----TLTNWHMDEKDLPPFVPLGTFRTVTEYFTQDRLALRIVT 177
            :||. |...|    .|||..:..|.....:|.|.:...|.:.|::  ..|:||
  Fly   131 TCPY-TKEKYISIDDLTNTEVSAKIRGVPMPKGFYALFTTWSTEN--ITRVVT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 22/84 (26%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 22/86 (26%)

Return to query results.
Submit another query.