DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33775

DIOPT Version :10

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:184 Identity:46/184 - (25%)
Similarity:76/184 - (41%) Gaps:35/184 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNALATSTLFWLLWFTNHIC-----LKCEERSFRIKM-----NE-FAVKYKMRDLIQHIDFRIVN 54
            |..||:|.|  :|.....:|     .:|..:|..|.|     || :||..|.:          :|
  Fly     1 MAELASSRL--ILVTAAILCSLSLGSECRSKSRFINMQCESYNESYAVFEKCK----------LN 53

  Fly    55 LNNRSYVNGEMIVK---SDVEDILMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIY 116
            |..|..|..:|.:|   :.||:..::..|  ::..|..:..||:...|.||.|...:......:.
  Fly    54 LLGRGRVGADMYLKLFQTPVENCWINWAM--YRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLV 116

  Fly   117 VKSFKKHIHGNLSCPLRTNFNYTLTNWHMDE---KDLPPFVPLGTFRTVTEYFT 167
            :.:.||..:.|.|||.  |.:..:.|....:   |.||  :|.|.::....:.|
  Fly   117 INAIKKGSNLNHSCPY--NHDIIVDNMEFSDDFLKTLP--LPQGVYKIQLRFAT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 21/83 (25%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 21/87 (24%)

Return to query results.
Submit another query.