DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33927

DIOPT Version :9

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:166 Identity:32/166 - (19%)
Similarity:66/166 - (39%) Gaps:35/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTNHICLKCEE-----RSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDI 74
            |||.:|....|     ...|:|    |::.....|  ..:..::...::..|:|::         
  Fly    30 FTNFVCDSVNETWLAVHQCRLK----AIRRGTTTL--SFNGTVLKTISKFRVHGQI--------- 79

  Fly    75 LMHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIY--VKSFKKHIHGNLSCPLRTNFN 137
                    :|.:|..|..||:...|.|:||:..:...:..::  :|||.   :.|.:||.....:
  Fly    80 --------FKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFS---NLNFTCPYMGPVH 133

  Fly   138 YTLTNWHMDEKDLPPFVPLGTFRTVTEYFTQDRLAL 173
              :...|:..:.:|..:|.|.:....:::....|.|
  Fly   134 --IMGLHIIGEQIPVPLPTGEYLIQIKWYISKTLFL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 19/82 (23%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.