DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33642 and CG33631

DIOPT Version :9

Sequence 1:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:88 Identity:22/88 - (25%)
Similarity:44/88 - (50%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTLTNWHMDEKDL-PPFVPLGTFR- 160
            ||.|.|.....:|.:.|.:::| :..:...:.||:|.. ||::.|  :..||: |..:..|.:: 
  Fly   107 LDLCGFFTEFRKNPMMKYFLQS-EMQLSDIIVCPVRVG-NYSVKN--VSVKDIYPQVLQNGIYKF 167

  Fly   161 --TVTEYFTQDRLALRIVTQGKV 181
              .|.|...:...||::.|:.::
  Fly   168 FVEVIEATAEKVFALQVTTEVRI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 17/62 (27%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.