DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33842 and AT4G40030

DIOPT Version :10

Sequence 1:NP_001027348.1 Gene:His3:CG33842 / 3771729 FlyBaseID:FBgn0053842 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001078516.1 Gene:AT4G40030 / 830164 AraportID:AT4G40030 Length:164 Species:Arabidopsis thaliana


Alignment Length:136 Identity:131/136 - (96%)
Similarity:134/136 - (98%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||:|||||||||||
plant    29 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRK 93

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||.||:|||||:|||||||||||||||||||||||||||||||||
plant    94 LPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 158

  Fly   131 IRGERA 136
            ||||||
plant   159 IRGERA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33842NP_001027348.1 PTZ00018 1..136 CDD:185400 129/134 (96%)
AT4G40030NP_001078516.1 PTZ00018 29..164 CDD:185400 129/134 (96%)

Return to query results.
Submit another query.