DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33842 and Hfe

DIOPT Version :9

Sequence 1:NP_001027348.1 Gene:His3:CG33842 / 3771729 FlyBaseID:FBgn0053842 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_445753.1 Gene:Hfe / 29199 RGDID:2793 Length:360 Species:Rattus norvegicus


Alignment Length:37 Identity:8/37 - (21%)
Similarity:18/37 - (48%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
            |:..::|:.....:|||....:.|:   :...|::.|
  Rat   315 SQDMIIGIISGITICAIFFVGILIL---VLRKRKVSG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33842NP_001027348.1 PTZ00018 1..136 CDD:185400 8/37 (22%)
HfeNP_445753.1 Alpha-1 26..127
MHC_I 31..215 CDD:298647
Alpha-2 128..218
Ig 219..311 CDD:299845
Alpha-3 219..310
Connecting peptide 311..319 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.