DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33842 and his-69

DIOPT Version :9

Sequence 1:NP_001027348.1 Gene:His3:CG33842 / 3771729 FlyBaseID:FBgn0053842 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_497811.1 Gene:his-69 / 184005 WormBaseID:WBGene00001943 Length:127 Species:Caenorhabditis elegans


Alignment Length:123 Identity:107/123 - (86%)
Similarity:115/123 - (93%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ 77
            ||||||||||||||||:|...|.||||||:|||||||||||||||||:||:||||||||||||||
 Worm     4 GGKAPRKQLATKAARKNAIVVGAVKKPHRFRPGTVALREIRRYQKSTDLLLRKLPFQRLVREIAQ 68

  Fly    78 DFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 135
            |.|.||||||:|:.|||||||.:||||||||||||||||||||||||:||||||||||
 Worm    69 DVKQDLRFQSAAIQALQEASEYFLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGER 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33842NP_001027348.1 PTZ00018 1..136 CDD:185400 107/123 (87%)
his-69NP_497811.1 Histone 1..123 CDD:278551 102/118 (86%)
PTZ00018 4..126 CDD:185400 105/121 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163172
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.