DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and SKOR

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_186934.1 Gene:SKOR / 821052 AraportID:AT3G02850 Length:828 Species:Arabidopsis thaliana


Alignment Length:202 Identity:52/202 - (25%)
Similarity:85/202 - (42%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KEQSPGLLQLQAK-----SKWQAWRNLGTMSQSAARQAYVQKLQEL-----QPNWR--SRRNPGW 100
            ||.:..:.||::.     ||.:|  .|.....|||....:.:|:.|     .||..  ..|:|  
plant   524 KESNVRIKQLESDITFHISKQEA--ELALKLNSAAFYGDLYQLKSLIRAGGDPNKTDYDGRSP-- 584

  Fly   101 VVHSIESVPLED-------QRLD-------SEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMA 151
             :|...|...||       :.:|       ....|.:.:|..| ||:..||.........|:...
plant   585 -LHLAASRGYEDITLYLIQESVDVNIKDKLGSTPLLEAIKNGN-DRVAALLVKEGATLNIENAGT 647

  Fly   152 LIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPLHYAASCG-HLEALQCLLELHASLELRDSDG 215
            .:.....:...:.::.|:.:|...|.:|.:.:||||.|||.| ::.|:| |:|..|::..:|..|
plant   648 FLCTVVAKGDSDFLKRLLSNGIDPNSKDYDHRTPLHVAASEGFYVLAIQ-LVEASANVLAKDRWG 711

  Fly   216 QTCYDVA 222
            .|..|.|
plant   712 NTPLDEA 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 13/51 (25%)
ANK 125..231 CDD:238125 29/99 (29%)
Ank_2 125..212 CDD:289560 24/87 (28%)
ANK repeat 148..179 CDD:293786 3/30 (10%)
ANK repeat 181..212 CDD:293786 13/31 (42%)
SKORNP_186934.1 PLN03192 70..827 CDD:215625 52/202 (26%)
ANK repeat 580..611 CDD:293786 7/33 (21%)
ANK repeat 613..644 CDD:293786 7/31 (23%)
ANK repeat 677..708 CDD:293786 13/31 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.