Sequence 1: | NP_001027085.1 | Gene: | anox / 3771728 | FlyBaseID: | FBgn0064116 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_186934.1 | Gene: | SKOR / 821052 | AraportID: | AT3G02850 | Length: | 828 | Species: | Arabidopsis thaliana |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 34/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 KEQSPGLLQLQAK-----SKWQAWRNLGTMSQSAARQAYVQKLQEL-----QPNWR--SRRNPGW 100
Fly 101 VVHSIESVPLED-------QRLD-------SEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMA 151
Fly 152 LIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPLHYAASCG-HLEALQCLLELHASLELRDSDG 215
Fly 216 QTCYDVA 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
anox | NP_001027085.1 | ACBP | 10..90 | CDD:279259 | 13/51 (25%) |
ANK | 125..231 | CDD:238125 | 29/99 (29%) | ||
Ank_2 | 125..212 | CDD:289560 | 24/87 (28%) | ||
ANK repeat | 148..179 | CDD:293786 | 3/30 (10%) | ||
ANK repeat | 181..212 | CDD:293786 | 13/31 (42%) | ||
SKOR | NP_186934.1 | PLN03192 | 70..827 | CDD:215625 | 52/202 (26%) |
ANK repeat | 580..611 | CDD:293786 | 7/33 (21%) | ||
ANK repeat | 613..644 | CDD:293786 | 7/31 (23%) | ||
ANK repeat | 677..708 | CDD:293786 | 13/31 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |