DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment anox and Eci3

DIOPT Version :9

Sequence 1:	NP_001027085.1	Gene:	anox / 3771728	FlyBaseID:	FBgn0064116	Length:	243	Species:	Drosophila melanogaster
Sequence 2:	NP_081223.1	Gene:	Eci3 / 69123	MGIID:	1916373	Length:	317	Species:	Mus musculus

Alignment Length:	119	Identity:	27/119 - (22%)
Similarity:	43/119 - (36%)	Gaps:	32/119 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 PGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNWRSRRNPGWVVHSIESVPLEDQRLD 116
            ||:.....|:.|.|...||::.:..||:.||..:..|.              |....|.:.:|..
Mouse     4 PGVFNFVNKATWDARNALGSLPKETARKNYVDLVSSLS--------------SSSEAPSQGKRGA 54

  Fly   117 SEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMALIHW--ATDRNAVEIIQFL 168
            .||.             ||   ..|::...|.|:..|.:  .|.:||:....:|
Mouse    55 DEKA-------------RE---SKDILVTSEDGITKITFNRPTKKNAISFQMYL 92

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
anox	NP_001027085.1	ACBP	10..90	CDD:279259	12/37 (32%)
		ANK	125..231	CDD:238125	10/46 (22%)
		Ank_2	125..212	CDD:289560	10/46 (22%)
		ANK repeat	148..179	CDD:293786	6/23 (26%)
		ANK repeat	181..212	CDD:293786
Eci3	NP_081223.1	ACBP	<2..37	CDD:376410	11/32 (34%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	40..60		6/46 (13%)
		crotonase-like	64..256	CDD:119339	7/29 (24%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:Q05871	120..124
		Microbody targeting signal. /evidence=ECO:0000255	315..317
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900