DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and acbd6

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001008065.2 Gene:acbd6 / 493427 XenbaseID:XB-GENE-989234 Length:286 Species:Xenopus tropicalis


Alignment Length:241 Identity:77/241 - (31%)
Similarity:122/241 - (50%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVDEL---FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNL 69
            |.:||   |..|.:||...::...:..||..|..|||...|.|....||....:.|.||:||:.|
 Frog    28 TEEELQGQFEQAAKHVQNGASVASTEQLLFLYARYKQVKVGRCNTPKPGFFDYEGKKKWEAWKAL 92

  Fly    70 GTMSQSAARQAYVQKLQELQPNW------RSRRNP-----GWVVHSIESVPLEDQRLDSEKTLFD 123
            |..|...|...|::.:::|.|:|      ...:.|     |.||..:..|  ::...:.:|.:||
 Frog    93 GDYSCQQAMNEYIETVKKLDPDWSPQALEEPHKEPKTTFGGPVVSCLYKV--QETLREEDKDIFD 155

  Fly   124 HVKENNLDRLRELLQPS--DLVKLDEHGMALIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPL 186
            :.:|||:.|:...|...  |:...|:.|..|:|||.||...:::..|:...|.:|.:|:|.||||
 Frog   156 YCRENNISRVSHALSTGAIDVNVADDEGRCLLHWACDRGHTQLVSVLLFHNAHINMQDSEGQTPL 220

  Fly   187 HYAASCGHLEALQCLLELHASLELRDSDGQTCYDVADDEQICQVLQ 232
            |||::|...:.:..||:..|...|.|:||...::|.|.:.|..:||
 Frog   221 HYASACEFPDIVDLLLDHGADPSLVDNDGFQPHEVTDSKNIAAMLQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 27/82 (33%)
ANK 125..231 CDD:238125 37/107 (35%)
Ank_2 125..212 CDD:289560 31/88 (35%)
ANK repeat 148..179 CDD:293786 10/30 (33%)
ANK repeat 181..212 CDD:293786 13/30 (43%)
acbd6NP_001008065.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
ACBP 35..113 CDD:279259 25/77 (32%)
Acyl-CoA binding. /evidence=ECO:0000250 59..63 1/3 (33%)
ANK 156..261 CDD:238125 36/104 (35%)
Ank_2 157..246 CDD:289560 31/88 (35%)
ANK repeat 182..213 CDD:293786 10/30 (33%)
ANK 1 182..211 9/28 (32%)
ANK repeat 215..246 CDD:293786 13/30 (43%)
ANK 2 215..244 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 136 1.000 Inparanoid score I4444
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - oto102748
Panther 1 1.100 - - LDO PTHR24119
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5885
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.