DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and Acbp6

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster


Alignment Length:80 Identity:22/80 - (27%)
Similarity:38/80 - (47%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAA 77
            |....|......|.....:.|.|||||||||.|.|..:.|.  ..:.|:::.||::...::...|
  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66

  Fly    78 RQAYVQKLQELQPNW 92
            :..|::..::..|.:
  Fly    67 KAYYIEVYKKYAPQY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 21/76 (28%)
ANK 125..231 CDD:238125
Ank_2 125..212 CDD:289560
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.