DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and CG8814

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster


Alignment Length:187 Identity:51/187 - (27%)
Similarity:79/187 - (42%) Gaps:35/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LLIFYGYYKQATNG-PCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNWRSR 95
            :|.|||.:||||.| |..::.||...:..|:|||||.:...:::..|.|.||:.|||:.......
  Fly    31 MLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDNRHLTKEEAMQRYVESLQEIIETMSFT 95

  Fly    96 RNPGWVVHSIESVPLEDQRLDSEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMALIHWATDRN 160
            .|....|.|::|                 :...:||.| ||:.|......:.|..:..|..|:. 
  Fly    96 ENVQNFVGSLDS-----------------LGNISLDEL-ELVSPGMKELAESHPNSPFHSRTNS- 141

  Fly   161 AVEIIQFLVRSGASVN-QRDAEQQTPLHYAASCGHLEALQCLLEL-HASLELRDSDG 215
                    .:.|:|.| :.:.|.|     |.|...|...:.:.|. |:|..|.:..|
  Fly   142 --------PQHGSSCNGEPEPEPQ-----ATSTAPLATSETIKENGHSSPPLTNGYG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 25/58 (43%)
ANK 125..231 CDD:238125 22/93 (24%)
Ank_2 125..212 CDD:289560 21/88 (24%)
ANK repeat 148..179 CDD:293786 6/31 (19%)
ANK repeat 181..212 CDD:293786 9/31 (29%)
CG8814NP_608729.1 ACBP 5..90 CDD:279259 25/58 (43%)
DUF1664 <217..272 CDD:285172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.