DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and Acbd6

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001011906.1 Gene:Acbd6 / 289125 RGDID:1305030 Length:282 Species:Rattus norvegicus


Alignment Length:257 Identity:88/257 - (34%)
Similarity:125/257 - (48%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TDTVDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLG 70
            |.::.|||..|..||...........||..|..|||...|.|....|.....:.|.||:||:.||
  Rat    39 TRSLAELFEKAAAHVQGLVQVASREQLLYLYARYKQVKVGNCNIPKPNFFDFEGKQKWEAWKALG 103

  Fly    71 TMSQSAARQAYVQKLQELQPNWRSRRNP---------------GWVVHSI---ESVPLEDQRLDS 117
            ..|.|.|.|.|:..:::|.|.|    ||               |.||.|:   |::..||     
  Rat   104 DSSPSQAMQEYIAAVKKLDPGW----NPQVSEKKGKEGSSGFGGPVVSSLYHEETIREED----- 159

  Fly   118 EKTLFDHVKENNLDRLRELLQPS--DLVKLDEHGMALIHWATDRNAVEIIQFLVRSGASVNQRDA 180
             |.:||:.:|||:|.:.:.::..  |:...||.|.||:|||.||...|:::.|::..|.:|.:|.
  Rat   160 -KNIFDYCRENNIDHITKAIKSKTVDVNMTDEEGRALLHWACDRGHKELVKVLLQCEAGINCQDN 223

  Fly   181 EQQTPLHYAASCGHLEALQCLLELHASLELRDSDGQTCYDVADDEQICQVLQTERERLAGSA 242
            |.||.|||||:|...:.::.||:..|...|||.||....:|...:.:..|||..|   ||.|
  Rat   224 EGQTALHYAAACEFSDIVELLLQSGADPTLRDQDGCLPEEVTGCKAVSLVLQLHR---AGKA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 28/79 (35%)
ANK 125..231 CDD:238125 38/107 (36%)
Ank_2 125..212 CDD:289560 33/88 (38%)
ANK repeat 148..179 CDD:293786 12/30 (40%)
ANK repeat 181..212 CDD:293786 13/30 (43%)
Acbd6NP_001011906.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
ACBP 44..123 CDD:279259 28/78 (36%)
Acyl-CoA binding. /evidence=ECO:0000250 69..73 1/3 (33%)
ANK 165..261 CDD:238125 37/95 (39%)
Ank_2 166..255 CDD:289560 33/88 (38%)
ANK repeat 191..222 CDD:293786 12/30 (40%)
ANK 1 191..220 11/28 (39%)
ANK repeat 224..255 CDD:293786 13/30 (43%)
ANK 2 224..253 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 139 1.000 Inparanoid score I4428
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - oto96008
orthoMCL 1 0.900 - - OOG6_104190
Panther 1 1.100 - - LDO PTHR24119
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.