DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and maa-1

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_499531.1 Gene:maa-1 / 176612 WormBaseID:WBGene00007680 Length:266 Species:Caenorhabditis elegans


Alignment Length:202 Identity:51/202 - (25%)
Similarity:82/202 - (40%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAY----VQKLQELQPNWR 93
            |.||..:||||:|.|....|....:|...||.||..|..|:...|:|||    |||::|:|..::
 Worm    28 LNFYALFKQATHGKCDLPKPSFYDIQGVYKWNAWNKLDNMTMDEAKQAYVDSIVQKIREVQKEYK 92

  Fly    94 SRRNPGW--------------VVHSIESVPLEDQRLDSEKTLFDHVKENNLDRLRELLQPSDLVK 144
            :..   |              |:..:|.   :||.::..|...:...||..|.:......:.::.
 Worm    93 TEE---WMKGDTYELLAPKFEVLGVLEG---KDQAVEHPKKTENKETENETDNVETPNSSACILS 151

  Fly   145 LDEHGMALIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPLHYAASCGHLEALQCLLELHASLE 209
            .:|:..|:......|::     .......|.|:|.:.|.:   ..:||..||.     ||....|
 Worm   152 DNEYADAIDDEIQSRSS-----SFTEPHNSFNRRISRQSS---LKSSCHRLEK-----ELKVITE 203

  Fly   210 LRDSDGQ 216
            ..|..|:
 Worm   204 SIDKLGK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 25/60 (42%)
ANK 125..231 CDD:238125 19/92 (21%)
Ank_2 125..212 CDD:289560 17/86 (20%)
ANK repeat 148..179 CDD:293786 4/30 (13%)
ANK repeat 181..212 CDD:293786 8/30 (27%)
maa-1NP_499531.1 ACBP 3..84 CDD:376410 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.