DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and ech-4

DIOPT Version :10

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001366707.1 Gene:ech-4 / 174665 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans


Alignment Length:51 Identity:18/51 - (35%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQ 83
            |..||.:||||.|..:.:.||::....::|:.||..|...:|..||..|.:
 Worm    49 LQLYGLFKQATAGDVQGKRPGMMDFVGRAKYDAWNTLKGQTQDEARANYAK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..85 CDD:459982 18/51 (35%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
ech-4NP_001366707.1 ACBP 25..109 CDD:238248 18/51 (35%)
CaiD 129..381 CDD:440647
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.