DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anox and eci2

DIOPT Version :9

Sequence 1:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_012819853.2 Gene:eci2 / 100216270 XenbaseID:XB-GENE-961246 Length:413 Species:Xenopus tropicalis


Alignment Length:169 Identity:47/169 - (27%)
Similarity:73/169 - (43%) Gaps:26/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQS 75
            |.|..|..::....|..|:...|..|..:||||.|||....||:|....|.||.||::||::.:.
 Frog    61 EDFEKAQSNLKLLKNDPGNEVKLKLYALFKQATQGPCNVPKPGMLDFVNKVKWDAWKSLGSLPKD 125

  Fly    76 AARQAYVQKLQEL---QPNWRSRRNPGWVVHSIESVPLEDQRLDSEKTLFDHVKENNLDRL---- 133
            .|||:||:.:..|   :.:.:|..:||......|::.:.              :|:|:.::    
 Frog   126 DARQSY
VELVSSLVSSESSTKSNADPGIGHKKYETIQVS--------------REDNIIKIFLNR 176

  Fly   134 RELLQPSDLVKLDEHGMALIHWATDRNAVEIIQFLVRSG 172
            .|......|....|.|.||.....|.:.     |.|.||
 Frog   177 PEKKNAITLTMYKEIGEALEEAGKDESV-----FAVLSG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anoxNP_001027085.1 ACBP 10..90 CDD:279259 30/81 (37%)
ANK 125..231 CDD:238125 13/52 (25%)
Ank_2 125..212 CDD:289560 13/52 (25%)
ANK repeat 148..179 CDD:293786 8/25 (32%)
ANK repeat 181..212 CDD:293786
eci2XP_012819853.2 ACBP 60..131 CDD:412233 27/69 (39%)
crotonase-like 161..411 CDD:419961 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.