DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG14259

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:85/253 - (33%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CARNEPLLERCIINAAYQIRPLLVHGNLG-----DGFPTSPLEPLSLDNIELKLSSQ----FQAV 93
            |...||...:|..|:   |:.||...|:|     :.|  .|.:|:.:.:|..|..:.    .:|.
  Fly    49 CRIYEPGFTKCSTNS---IQKLLDQLNIGIPEVLERF--GPFDPMRVRDIVFKQDNNEVATIRAN 108

  Fly    94 FKDLEANGGNYT--------------------------GKYSLHLNLLLPDIKGKGNMQGYCENA 132
            ..||...|...|                          |:|.:...:||..:.|.|         
  Fly   109 LTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIPLSGSG--------- 164

  Fly   133 KAFV-----------KIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSG-DRFLGDVGNS 185
            |.|:           |||  .|.:.|..:...:.:...::....:..|.|||:| .:.:....|.
  Fly   165 KIFIEIDDLDILLLTKIR--LYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNE 227

  Fly   186 LINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDEMFPPGKTFVSPITHPPRL 243
            ..|.|...:.:.:.|.:...:.....||     .|..|..:  |...||..|..|.:|
  Fly   228 FFNENWRDFYEALKPLIVETVENILYDV-----MSTVFHLI--PANFFVEDIPTPQQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 46/236 (19%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 47/242 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.