DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG11854

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:233 Identity:51/233 - (21%)
Similarity:83/233 - (35%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LERCII--------NAAYQIRPLLVHG--NLGDGFPTSPLEPLSLD------------NIELK-- 85
            :|||.|        ...:.:|.....|  .||    ..||:||.:.            ||:|.  
  Fly    27 IERCAIMDEQCLEDRVNFVLRNYAKSGIKELG----LIPLDPLHVKKFKIGRNPHSPVNIDLSFH 87

  Fly    86 ---------------------LSSQFQAVFKDLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYC 129
                                 ||...:.|   :|.......|.||:...:|:..|.|.|......
  Fly    88 EMDILGLHQGVAKRVSGFTRDLSRSIELV---MEVPEIGVRGPYSVDGRILILPITGNGIADIRL 149

  Fly   130 ENAKAFVKIRGSRYLR-NGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQEL 193
            ...|...:|:..|..: :.:.|.:...:...:|......:|.|||:|.:.|.:..::|||.|   
  Fly   150 TRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQKDLSENMHALINEN--- 211

  Fly   194 YLKDIAPSLEHGLSKHF----LDVADKILASATFDEMF 227
             .|||...|:.|:.:.|    ..|.|:|......:::|
  Fly   212 -WKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 51/233 (22%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.