DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG17279

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:56/248 - (22%)
Similarity:91/248 - (36%) Gaps:57/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IFLLAFTITP-CARNEPLLER-------CIINAAYQIRPLLVHG--NLG------DGFP---TSP 73
            :|:....:.| ..:..|.:|:       ||.....:|..|...|  ::|      .||.   .|.
  Fly     5 VFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYPKGLPSIGLVALDSIGFEDVVVSR 69

  Fly    74 LEPLSLDNIELKLSSQFQAVFKD----------------LEANGG----NYTGKYSLHLNLLLPD 118
            |||......:||..:.....|.|                ||.:|.    ...|.|.:..:||...
  Fly    70 LEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGSLLTMP 134

  Fly   119 IKGKGNMQGYCENAKAFVKIRGSRYLR-NGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDV 182
            |.|||..:......:...|:|....|| :||.|...||:..|:|.:...|.|.|||:... :.|.
  Fly   135 IHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPE-MSDA 198

  Fly   183 GNSLINNNQELYLKDIAPSLEHGLSKHFLDVADKILAS--------ATFDEMF 227
            .|.:.|..   :|:     :.|.|.:......|:::.|        ..:|:::
  Fly   199 MNVVANTK---WLE-----IWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 55/245 (22%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 56/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.