DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG10407

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:231 Identity:55/231 - (23%)
Similarity:105/231 - (45%) Gaps:49/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CARNEPLLERCIINAAYQIRPLLVHGNLGDGFP---TSPLEPLSLDNIELKLSS---QFQAVFKD 96
            |.||.|.|:.|:..:..::||.|:     :|.|   ...:|||.:..:::...|   ...:|:::
  Fly    41 CHRNAPDLDTCVRESYEELRPRLM-----EGIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRN 100

  Fly    97 LEANG-GNYT--------GKYSLHLNLLLPDI------------KGKGNM-----QGYCE----N 131
            ::..| ..:|        .|....|:|..|.:            :||..|     .|:|:    |
  Fly   101 VKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVN 165

  Fly   132 AKAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLK 196
            .....::.|..|.:||.:::|.:.:....:..|..:.|.|||:||:.|||..|..:|.|.:...:
  Fly   166 ITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAE 230

  Fly   197 DIAPSLEHGLSKHFLDV----ADKILASATFDEMFP 228
            ::.|.    ::|..:|:    .||:.||.::|::.|
  Fly   231 EVRPL----MTKALVDILRASVDKLFASFSYDDLLP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 54/229 (24%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 54/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D95178at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.