DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG10264

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:83/208 - (39%) Gaps:41/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CARNEPLLERCIINAAYQIRPLLVHG--NLGDGFPTSPLEPLSLDNI-------ELKLSSQFQAV 93
            |.|:.|..::|.........|.|..|  .:|    ....|||::|.:       .|.||..||.:
  Fly    51 CKRSNPNEDKCFRQLFEGCFPALAAGIPEIG----VKSFEPLNIDQVSVSKGSGNLVLSGGFQDL 111

  Fly    94 F-------------KDLEANGGNY---------TGKYSLHLNLLLPDIKGKGNMQGYCENAKAFV 136
            .             .|||....|:         ..||:|..|:||..:.|.|::....:|....|
  Fly   112 VIRGPSNATVRRASLDLERRLLNFELELPRLRIRAKYNLKGNILLLPLVGSGDVAMALKNVHTTV 176

  Fly   137 KIRGSRYLRN----GKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKD 197
            ..|.|  |||    |.:.:...:|....|....::.|.|||:|:..|....||.:|.|.:..:.:
  Fly   177 YTRIS--LRNETRTGDEIIHIDEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAE 239

  Fly   198 IAPSLEHGLSKHF 210
            :.|.||.||:..|
  Fly   240 LRPDLELGLADIF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 55/208 (26%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 55/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.