DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG14457

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:280 Identity:68/280 - (24%)
Similarity:101/280 - (36%) Gaps:83/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 INIFLLAFTITPCA-------RNEP--------LLERCIIN-AAYQIRPLLVHGNLGDGFP--TS 72
            :.:.:|..|.|.|.       ..||        :.::..:| :.:.|:.|.  ..|.||.|  ||
  Fly     4 LELIVLLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLF--DKLNDGIPGLTS 66

  Fly    73 --PLEPLSLDNIELK--------------------------LSSQFQAVFKDLEANGGNYTGK-- 107
              ..:|..|:.|.:.                          |.||   |||.      :|:.|  
  Fly    67 IRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQ---VFKK------DYSWKTT 122

  Fly   108 -----------YSLHLNLLLPDIKGKGNMQGYCENAKAFVKIRGSRYLRNGKDYVKFSKMTTL-I 160
                       |||...:||..:.|||.:....||....:..:...|.:.|   ..|..:|.| :
  Fly   123 FTLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGG---FTFYNVTNLHV 184

  Fly   161 DFKDFKLK--LANLFSGDRFLGDVGNSLINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATF 223
            |||...||  .:|||:|::.|.|..|...|:|..:....:...:...:....|||..||.     
  Fly   185 DFKMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIF----- 244

  Fly   224 DEMFPPGKTFVSPITHPPRL 243
              .|.|...|||.|..|.:|
  Fly   245 --HFIPANFFVSDIPTPEQL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 60/258 (23%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.