DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and CG3246

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:213 Identity:52/213 - (24%)
Similarity:82/213 - (38%) Gaps:81/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AYQIRPLLVHGNLGD--GFPTSPL-EPLSLDNIELKLS--------------SQFQ-----AVFK 95
            |.|:..:|||....|  |.|..|: :||.:.|::..:.              |:|:     ...|
  Fly    50 AAQVEAMLVHFQQEDPQGLPGVPVPDPLEVPNVKKSMGMANLDMKQVKAYGLSKFRIDKMNLDLK 114

  Fly    96 DLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYCENAK---------------AFVKIRGSRYLR 145
            ::..|||       |.|:.:|  :||:..:..:...|.               ||:.:.     |
  Fly   115 EMRFNGG-------LQLDQML--VKGQYTLSSFFSKANGPFTVVLKNVYAEATAFLAVE-----R 165

  Fly   146 NGK---DYVK----FSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDIAPSLE 203
            :|:   |.:|    ||.||  :||::..|           :|.|..|::|.         ||:|.
  Fly   166 DGQLATDRIKIDITFSDMT--MDFQNLGL-----------VGSVFQSVVNG---------APNLV 208

  Fly   204 HGLSKHF-LDVADKILAS 220
            ....|.| |..|||.|.|
  Fly   209 FDAMKPFMLQEADKKLRS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 52/213 (24%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 52/213 (24%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.