DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33680 and dyw

DIOPT Version :9

Sequence 1:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:63/159 - (39%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TSPLE-PLSLDNIELKLSSQFQAVFKDLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYCENAKA 134
            |.||: .|.|||.||::.:                  ||.:...||:..|..||::.....:...
  Fly   117 TRPLKLTLLLDNPELEVRA------------------KYDVDGKLLILPIVSKGDLTIRLNDVHT 163

  Fly   135 FVKIRGSRYLR-NGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDI 198
            .|.|......| :|..|:..:...|....|.....|:|||:.::.|.|....::|........|:
  Fly   164 KVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQEWSTLALDV 228

  Fly   199 APSLEHGLSKHFLDVADKILASATFDEMF 227
            .|.:....:|.|..:...:.|:..:||.|
  Fly   229 QPKINEACAKAFSAIVQSLWANIPYDEFF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 38/159 (24%)
dywNP_570016.1 JHBP 29..258 CDD:214779 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.