DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or98a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:383 Identity:148/383 - (38%)
Similarity:232/383 - (60%) Gaps:5/383 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VSSLDASDYYYRIAFFLGW-TPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHFDRFTPT 81
            ::|.|:..|:....|.:|| ||....::.:|.|  .|...|.. ||||:|:.:::....:.|||.
  Fly    15 LTSPDSFRYFEYGMFCMGWHTPATHKIIYYITS--CLIFAWCA-VYLPIGIIISFKTDINTFTPN 76

  Fly    82 EFLTSLQVDINCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVIL 146
            |.||.:|:..|.:|...|.......:..|.:..:|:|.:||||.|..:|...|:.|.|.|...::
  Fly    77 ELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLI 141

  Fly   147 FLSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYA 211
            :...|..:...|..::..:||.||::|||.||:|:.....|.|::.|..::.....|.||||.|.
  Fly   142 YQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYP 206

  Fly   212 IVFISLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQF 276
            :::..:.|.||.:||.|:.:|..|...|:.|:.:.::.||:||..||..:..|||.::.|||.||
  Fly   207 LLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQF 271

  Fly   277 MLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWI 341
            :|:||.|||:.|::|||.: |||.:|.|::|..:..::||.|.:|:.|.:|...:.:|:||||||
  Fly   272 LLIGICLGLSMINLLFFAD-IWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWI 335

  Fly   342 TADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQMNLGEK 399
            .:.|||||::.|||..||:.|.||||||||||..|||.|||.||:::|.|||:|:.::
  Fly   336 NSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLNIADR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 123/305 (40%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 123/305 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468547
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.