DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or94a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:375 Identity:73/375 - (19%)
Similarity:151/375 - (40%) Gaps:45/375 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WIYSL-----WTLTTM----WLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQV---DINCIGNVI 98
            |.:||     ||.|..    :..:::||:..:...:...:.|..:....:.||   .|..:..|:
  Fly    24 WPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVV 88

  Fly    99 KSCVTY---SQMWRFRRMNELISSLDKRCVTTTQ------RRIFHKMVARVNLIVILFLSTYLGF 154
            |....:   ::.||.  |.||..:.|.:.....:      .:.|.|....:.:::.|.: .|.| 
  Fly    89 KILSIWHYRTEAWRL--MYELQHAPDYQLHNQEEVDFWRREQRFFKWFFYIYILISLGV-VYSG- 149

  Fly   155 CFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDT---YAIVFIS 216
            |...||...:  :.|:..|.|. :|:... :.|.|...:...:::..:..:..||   |.:..||
  Fly   150 CTGVLFLEGY--ELPFAYYVPF-EWQNER-RYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHIS 210

  Fly   217 LFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTI----IQCSQIIRP-ILSITIFAQF 276
            |....|.:......|::.|....     :|:.|....|:.|    :.|.:|:.| |||..|.:..
  Fly   211 LLYRLLGLRLRETKNMKNDTIFG-----QQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSAL 270

  Fly   277 MLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWI 341
            ::......|..:.|...|....:::..||  |.|.....||....|..:..: .::|.::|:||:
  Fly   271 IICFSGYRLQHVGIRDNPGQFISMLQFVS--VMILQIYLPCYYGNEITVYAN-QLTNEVYHTNWL 332

  Fly   342 TADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIV 391
            ......:..:..::...::|:...||:.|.:.:...:.....|::.:.::
  Fly   333 ECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 63/325 (19%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 63/322 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.