DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or88a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:459 Identity:81/459 - (17%)
Similarity:148/459 - (32%) Gaps:155/459 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKFFFKRLQTAPLDQEVSSLDASDYYYRIAFFL--------GWTPPKGALLRWIYSLWTLTTMW 57
            |..|.::|   .|:|.  |.::||...:.::.||        ||.              .:...|
  Fly    27 MVHFQWRR---NPVDN--SMVNASMVPFCLSAFLNVLFFGCNGWD--------------IIGHFW 72

  Fly    58 LG---------------------IVYLPLGLSLTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSC 101
            ||                     ::||.....:.:|...||..|.:.::.|.:.::         
  Fly    73 LGHPANQNPPVLSITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMD--------- 128

  Fly   102 VTYSQMW-RFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLG---FCF--LTLF 160
            .||...| |:|.:                 ||:                ::||   ||.  |.||
  Fly   129 ETYRNFWQRYRFI-----------------RIY----------------SHLGGPMFCVVPLALF 160

  Fly   161 TSVFAGKAPWQLYNPLVDWRKGHWQL---WIASILE-----YCVVSIGTMQELMSDTYAIVFISL 217
            .....||.     .|:..    |.||   |:...:.     |.:|   ...:||..|..:.|...
  Fly   161 LLTHEGKD-----TPVAQ----HEQLLGGWLPCGVRKDPNFYLLV---WSFDLMCTTCGVSFFVT 213

  Fly   218 FRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQ-------------DHRTIIQCSQIIRPILS 269
            |        |.:.|:.|...:..:.|..:..:.|.             |.|.::|..|::..:..
  Fly   214 F--------DNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCR 270

  Fly   270 --ITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTE----------SFPCCMLCE 322
              ..||....||...:|..::....|      :::..|.::.|...          :|..|:...
  Fly   271 KYNDIFKVAFLVSNFVGAGSLCFYLF------MLSETSDVLIIAQYILPTLVLVGFTFEICLRGT 329

  Fly   323 HLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTI 387
            .|.:.|..:.::|....|....|.|:...|.:....|:..|..|..:..:::.....:.:.|:.:
  Fly   330 QLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRL 394

  Fly   388 ITIV 391
            .|.:
  Fly   395 FTFL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 59/344 (17%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/384 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.