DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or85f

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:408 Identity:83/408 - (20%)
Similarity:168/408 - (41%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLRWIYSLWTLTT--MWLGIVYLPL-------GLSL--------TYVKHFDRFTPTEFLTSLQVD 90
            :|.|||....|.:  :.:|::...:       .:||        ||:.:.|    |:|.|.||  
  Fly    37 ILYWIYRFLCLASHGVCVGVMVFRMVEAKTIDNVSLIMRYATLVTYIINSD----TKFATVLQ-- 95

  Fly    91 INCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQRRIFHKMVARVN---------LIVIL 146
                    :|.:        :.:|..::.|..:   ||..||:|    |||         .:||:
  Fly    96 --------RSAI--------QSLNSKLAELYPK---TTLDRIYH----RVNDHYWTKSFVYLVII 137

  Fly   147 FLSTYLGFCFLTLFTSVFAGKA----------PWQLYNPLVDWRKGHWQLWIASILEYCVVSIGT 201
            ::.:.:......:.||:.|...          |:.||:|..|      .:|| .|..|.:..:.:
  Fly   138 YIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKD------PVWI-YISIYALEWLHS 195

  Fly   202 MQELMSDTYAIVFISLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRP 266
            .|.::|:..|.:::..|:..:        ||          |:..::..:.||:..::..|..|.
  Fly   196 TQMVISNIGADIWLLYFQVQI--------NL----------HFRGIIRSLADHKPSVKHDQEDRK 242

  Fly   267 ILSITIFAQFMLVGIDLGLAAI-------SILFFPNTIWTI----------MANVSFIVAICTES 314
            .::..:..|..||.:...|..|       |:|.....|.|:          :...::::.|.|..
  Fly   243 FIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSV 307

  Fly   315 FPCCMLC---EHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQS 376
            ....::|   :.:::.|..|::|:::.::..|..:||..:|..:.|||||::..|.....||:.:
  Fly   308 MQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDT 372

  Fly   377 NIAVAKFAFTIITIVNQM 394
            ...:...::.:||::.||
  Fly   373 FKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 68/344 (20%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 73/366 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.