DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or85e

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:469 Identity:86/469 - (18%)
Similarity:154/469 - (32%) Gaps:170/469 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WTPPK----GALLRWIY-SLWTLTTMWLGIVY-------LPLG--------LSLTYVKHFDRFTP 80
            |.|.:    |.:|...| |:...|::.||:::       ||.|        |::|.:..|..:  
  Fly    50 WWPKRLEMIGKVLPKAYCSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGY-- 112

  Fly    81 TEFLTSLQVDINCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVI 145
                           ..|..|:      |.||:...:..::        |...|..:|.|.    
  Fly   113 ---------------GTIYWCL------RSRRLLAYMEHMN--------REYRHHSLAGVT---- 144

  Fly   146 LFLSTYLGFCFLTLFT-----SVFAGKAPWQLYNPLVDWRKGHWQLW------------------ 187
             |:|::..|.....||     |...|...|.:...::..|....|.|                  
  Fly   145 -FVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIRMLPLQCWYPFDALGPGTYTAVYATQ 208

  Fly   188 -IASILEYCVVSIG-----TMQELMSDTYAIVFISL--FRCHLAILR----DRIANLRQDPKLSE 240
             ...|:.......|     |:..|:...:.:::.||  ...|..:|.    :.:::|:::..|.:
  Fly   209 LFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGD 273

  Fly   241 -----------MEH--------------------YEQMVACIQDHRTIIQCSQ----IIRP---I 267
                       .||                    :..:|.||:.||.|:.|||    :..|   :
  Fly   274 SKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELENLFSPYCLV 338

  Fly   268 LSITIFAQFML---VGID--------------LGLAAISILFFPNTIWTIMANVSFIVAICTESF 315
            .|:.|..|..|   ||:.              |||....:|.|               ..|.|  
  Fly   339 KSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMF---------------TYCGE-- 386

  Fly   316 PCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAV 380
               :|..|    |:...:|.:...|.......:..:|.||..:::.:..|||..:.:.|....:|
  Fly   387 ---LLSRH----SIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSV 444

  Fly   381 AKFAFTIITIVNQM 394
            ...||:.:|::.::
  Fly   445 ITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 68/395 (17%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 66/365 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.