DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or83c

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:306 Identity:59/306 - (19%)
Similarity:101/306 - (33%) Gaps:109/306 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSVFA-----GKA 168
            |||.:::.|:||                   .||:.:.|||..|.|.:.| :|::||     |..
  Fly    10 RFRELSKYINSL-------------------TNLLGVDFLSPKLKFNYRT-WTTIFAIANYTGFT 54

  Fly   169 PWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRDRIANLR 233
            .:.:.|...|||                  :|....||:..   :|..|.:....:|:.      
  Fly    55 VFTILNNGGDWR------------------VGLKASLMTGG---LFHGLGKFLTCLLKH------ 92

  Fly   234 QDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVG----------IDLGLAAI 288
                              ||.|.::..||        :|:.::...|          ||..|..:
  Fly    93 ------------------QDMRRLVLYSQ--------SIYDEYETRGDSYHRTLNSNIDRLLGIM 131

  Fly   289 SILFFPNTIWTIMANVSFIVAIC-TESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVL 352
            .|:           ...::.|.| .|..|..|    |:.|...|:...:....:..:.:|...|.
  Fly   132 KII-----------RNGYVFAFCLMELLPLAM----LMYDGTRVTAMQYLIPGLPLENNYCYVVT 181

  Fly   353 YFLHRAQQPIQ---FTAGSIFPISVQSNIAVAKFAFTIITIVNQMN 395
            |.:......:|   |.:|.:|.....:.|..  ||..:...|.::|
  Fly   182 YMIQTVTMLVQGVGFYSGDLFVFLGLTQILT--FADMLQVKVKELN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 56/294 (19%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 36/209 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.