DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or83a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:429 Identity:88/429 - (20%)
Similarity:145/429 - (33%) Gaps:112/429 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFFFKRLQTAPLDQEVSSLDASDYYYRIAFFLGWTPPKGA-------LLRWIYSLWTLTTMWLG- 59
            |.:|:|.:...|:..:|::: .:|..|.|....:....|:       :..::|..:..|..||. 
  Fly   104 KLYFRRFRPGLLNTILSNIN-DEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLAL 167

  Fly    60 -IVYLPLGLSLTYVKHFDRFTP----TEFLTSLQVDINCIGNVIKS-------CVTYSQMWRFRR 112
             |.|....|.|.....||...|    ..||......|....:...|       ||..|..:    
  Fly   168 PIAYRDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQY---- 228

  Fly   113 MNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSVFAGKAPWQLYNPLV 177
             :.|..||..                       :..|:|:      |..:........|......
  Fly   229 -DVLFCSLKN-----------------------VLASSYV------LMGANMTELNQLQAEQSAA 263

  Fly   178 DWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRDRIANLRQDPKLSEME 242
            |...|.:        .|.|.....:|||:....::.|.|.||.                      
  Fly   264 DVEPGQY--------AYSVEEETPLQELLKVGSSMDFSSAFRL---------------------- 298

  Fly   243 HYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWT----IMAN 303
               ..|.|||.||.|:...:.|....|...|.:...|...:.|.|     |.:|..|    .|..
  Fly   299 ---SFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVA-----FVSTKSTAANSFMRM 355

  Fly   304 VS---FIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFT 365
            ||   :::.:..|.|..|...:.:.::|.....||:.|.|....:..:|..::|:..:::..|.|
  Fly   356 VSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLT 420

  Fly   366 AGSIFPISVQSNIAVAKF------AFTIITIVNQMNLGE 398
            ||.|      ||:.|.:|      ||:.:|::.:|:..|
  Fly   421 AGKI------SNLNVDRFRGTITTAFSFLTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 64/329 (19%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 74/362 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.