DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or67d

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:383 Identity:83/383 - (21%)
Similarity:149/383 - (38%) Gaps:75/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YSLWTLT----------------TMWLGIVYLPLGLSLTYVKHFDRF--TPTEFLTSLQVDINCI 94
            :.:|.||                |:::|:|   :...||.:......  :..:.||.|.|..|..
  Fly    36 FRMWWLTYAVMAAIAFFFACTGYTIYVGVV---INGDLTIILQALAMVGSAVQGLTKLLVTANNA 97

  Fly    95 GNVIKSCVTYSQMWR--FRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLS---TYLGF 154
            .::.:...||..::|  ..:.:|....|:||.      ||...::....|:.|:.|.   |:..|
  Fly    98 SHMREVQNTYEDIYREYGSKGDEYAKCLEKRI------RITWTLLIGFMLVYIILLGLVITFPIF 156

  Fly   155 CFLTLFTSVFAGKAPWQLYNPLVDWRK--GHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISL 217
            ..|.|...|..    .|...|.:|...  ||..|..|.::   :::.|.......|.|..:|:: 
  Fly   157 YLLILHQKVLV----MQFLIPFLDHTTDGGHLILTAAHVI---LITFGGFGNYGGDMYLFLFVT- 213

  Fly   218 FRCHLAILRD----------RIANLRQD-PKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSIT 271
               |:.:::|          .:...|.| ||:..|     :...:..|:...:..|..:.|.||.
  Fly   214 ---HVPLIKDIFCVKLTEFNELVMKRNDFPKVRAM-----LCDLLVWHQLYTRMLQTTKKIYSIV 270

  Fly   272 IFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCM--LCEHLIED--SVHVS 332
            :|.|.....:.| |..||.:|.  ..|..........||...:| |.:  |.|:..||  ||..:
  Fly   271 LFVQLSTTCVGL-LCTISCIFM--KAWPAAPLYLLYAAITLYTF-CGLGTLVENSNEDFLSVIYT 331

  Fly   333 NALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAK--FAFTII 388
            |.|    |.......:..::..|.:||..:..||..:.|:|:.:.:.:.|  ::|:::
  Fly   332 NCL----WYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 74/329 (22%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 76/340 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.