DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or67c

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:448 Identity:83/448 - (18%)
Similarity:164/448 - (36%) Gaps:115/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FKRLQTAPLDQEVSSLDASDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMWLGIV---YLPLGL 67
            |..|...|: |...::....|.:|.      |.|..:||..||       ::.|.:   .|.:| 
  Fly    12 FMELMRVPV-QFYRTIGEDIYAHRS------TNPLKSLLFKIY-------LYAGFINFNLLVIG- 61

  Fly    68 SLTYVKHFDRFTPTEFLTSLQVDINCI--GNVIKSCVTYSQMWRFRR---------MNELISSLD 121
            .|.:           |..|:| |...|  ...:..|:.:|.:..|::         :..|:..|:
  Fly    62 ELVF-----------FYNSIQ-DFETIRLAIAVAPCIGFSLVADFKQAAMIRGKKTLIMLLDDLE 114

  Fly   122 KRCVTTTQRRI------FHKMVARVNLIVILFLSTYLGFCFLTLFTSVFAGKAP----------- 169
            .....|..:::      |.|.:.||     :.:.|:|...:.|.|:...|.||.           
  Fly   115 NMHPKTLAKQMEYKLPDFEKTMKRV-----INIFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTF 174

  Fly   170 --------WQLY----NPLVDWRKGHWQL----WIASILEYCVVSIGTMQELMSDTYAIVFISLF 218
                    |..:    |.|:.|.. :|.:    ::|.|...|           :|...:|.|:..
  Fly   175 DRNFGFLIWFPFDATRNNLIYWIM-YWDIAHGAYLAGIAFLC-----------ADLLLVVVITQI 227

  Fly   219 RCHLAI----LRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLV 279
            ..|...    |.|...|..:|     .|:.|.::..|:.|...::..:.:..:.|.::...|::.
  Fly   228 CMHFNYISMRLEDHPCNSNED-----KENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMA 287

  Fly   280 GIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITAD 344
            .:.:...|..:.  .:|:..|:....|::....:.|..|...:.||..|:.|.:|.::..|....
  Fly   288 SMQICFIAFQVT--ESTVEVIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCS 350

  Fly   345 RSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQMNLGEKFFS 402
            :||.:.:...:.|:|:|......:..|||             ::|.:..:::..:||:
  Fly   351 KSYCTMLKLLIMRSQKPASIRPPTFPPIS-------------LVTYMKVISMSYQFFA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 64/353 (18%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 59/341 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.