DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or67a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:428 Identity:75/428 - (17%)
Similarity:148/428 - (34%) Gaps:136/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYYYRIA--FF--LGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHF--------DR 77
            |.:.|:|  |:  ||..|         |......|:|..| |..|.: ...|..|        ||
  Fly    16 DDFLRLAVKFYNTLGIDP---------YETGRKRTIWFQI-YFALNM-FNMVFSFYAEVATLVDR 69

  Fly    78 FTPTEFLTSLQVDINCIGNVIKSCVTYSQ--------------MWRFRRMNELISSLD------- 121
            ....|             |.::||:..|.              |.:..:|..|:..|:       
  Fly    70 LRDNE-------------NFLESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPS 121

  Fly   122 -------------KRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLF------------- 160
                         |||      .|:.|....      ||:..|.....:.||             
  Fly   122 AKVQEEYAVKSWLKRC------HIYTKGFGG------LFMIMYFAHALIPLFIYFIQRVLLHYPD 174

  Fly   161 ---TSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHL 222
               ...|....||:.        :..|..:.:...:.......|...:..|      :.:|...|
  Fly   175 AKQIMPFYQLEPWEF--------RDSWLFYPSYFHQSSAGYTATCGSIAGD------LMIFAVVL 225

  Fly   223 AILR--DRIANLRQDPKL-------SEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFM- 277
            .::.  :|:|.:.::.|:       ...|...::.:.:.:|..|::.:.::..:..|.:...|: 
  Fly   226 QVIMHYERLAKVLREFKIQAHNAPNGAKEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIA 290

  Fly   278 ------LVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALF 336
                  |||:.|.: |:|..:|       ...:.|::::..|.:..|...:.||:.|.:|.:|.:
  Fly   291 SALLVCLVGVQLTI-ALSPEYF-------CKQMLFLISVLLEVYLLCSFSQRLIDASENVGHAAY 347

  Fly   337 HSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISV 374
            ..:|:.:|:.:|..:::...|:|:|:...|..:..:|:
  Fly   348 DMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 58/362 (16%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 57/345 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.