DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or45b

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:406 Identity:80/406 - (19%)
Similarity:138/406 - (33%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WIYSLWTLTTM--------------WLGIVYLPLGLSLTYVKHFDRFTP--TEFLTSLQVDINCI 94
            |::.||.:...              |..:...|       |...|.|.|  ..|.|..::     
  Fly    37 WLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSP-------VDAMDAFCPLACSFTTLFKL----- 89

  Fly    95 GNVIKSCVTYSQMWRFR--------RMNELISSLDKRCVTTTQRRI----FHKMVARVNLIVILF 147
                      ..||..|        |:..||...:||  ..::|::    ::.||.|..::|   
  Fly    90 ----------GWMWWRRQEVADLMDRIRLLIGEQEKR--EDSRRKVAQRSYYLMVTRCGMLV--- 139

  Fly   148 LSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGH----------------------------W 184
                  |...::.|..|..::.|::      |.:.|                            :
  Fly   140 ------FTLGSITTGAFVLRSLWEM------WVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLY 192

  Fly   185 QLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILR----DRIANLRQDPKLSEMEHYE 245
            ..|...:..|...  ||.......|..:.|:      |..||    |.:..:| ||.|.|.:...
  Fly   193 STWSGQVTVYAFA--GTDGFFFGFTLYMAFL------LQALRYDIQDALKPIR-DPSLRESKICC 248

  Fly   246 QMVACIQD-HRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVA 309
            |.:|.|.| |..|.:..:....|::...|..|:...:.:..:.|.||.:..  :.|:..|.:...
  Fly   249 QRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSG--YNIIRYVVYTFT 311

  Fly   310 ICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISV 374
            :.:..|..|.....:..:|:.:..|.:.|.|.|.||..:..|...:.|||:||.... ..|..|:
  Fly   312 VSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSL 375

  Fly   375 QSNIAVAKFAFTIITI 390
            ....:|.||..:|:.:
  Fly   376 PVFTSVIKFTGSIVAL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 71/352 (20%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 75/368 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.