DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or43a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:201 Identity:45/201 - (22%)
Similarity:97/201 - (48%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LMSDTYAIVFISLF-------RCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDH----RTII 258
            |:|..| :.|:|||       :..|.||..|:..:..:.: ||.|.::::.:||..|    |.:.
  Fly   180 LLSMMY-MPFVSLFAGLAIFGKAMLQILVHRLGQIGGEEQ-SEEERFQRLASCIAYHTQVMRYVW 242

  Fly   259 QCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWT---IMANVSFIVAICTESFPCCML 320
            |.::::..|:::.        .|..|....|:||..|.|.:   :::.|.:|:.:....|.....
  Fly   243 QLNKLVANIVAVE--------AIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNR 299

  Fly   321 CEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISV---QSNIAVAK 382
            ...:..::..|:.|:::..|..|...::..:|.||.:.|.|::...|:::|:::   ||.:..:.
  Fly   300 ANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASY 364

  Fly   383 FAFTII 388
            ..||::
  Fly   365 SYFTML 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 43/196 (22%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.