DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or33b

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:377 Identity:83/377 - (22%)
Similarity:166/377 - (44%) Gaps:52/377 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WIYSLWTL--------------------TTMWLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQVD 90
            |:|  |.|                    .|:|..| :|.|||               |:.....|
  Fly    18 WLY--WHLLGLESNFFLNRLLDLVITIFVTIWYPI-HLILGL---------------FMERSLGD 64

  Fly    91 INCIGNVIKSCVTYSQM----WRF-----RRMNELISSLDKRCVTTTQRRIFHKMVAR-VNLIVI 145
            : |.|..|.:...::..    :||     :.:..|...||:|.::..:...|::...| .|.|..
  Fly    65 V-CKGLPITAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREANFIWK 128

  Fly   146 LFLSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQL--WIASILEYCVVSIGTMQELMSD 208
            .|:..| |...::...||..|.....||.....:.....:|  |::...:...||:..:|.|.:|
  Fly   129 SFIVAY-GLSNISAIASVLFGGGHKLLYPAWFPYDVQATELIFWLSVTYQIAGVSLAILQNLAND 192

  Fly   209 TYAIVFISLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIF 273
            :|..:...:...|:.:|..|::.:.|.|:.:.....:|::..|:|||.:::..:::|..::|:..
  Fly   193 SYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQLIESIEDHRKLMKIVELLRSTMNISQL 257

  Fly   274 AQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHS 338
            .||:..|:::.:..::||||.:..:.|.....:.:::..|.||||.....:..:...::.|::.|
  Fly   258 GQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSS 322

  Fly   339 NWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITI 390
            ||::.:|||...:|.|:......:|..||.:..|.:.:..|..:.|::..|:
  Fly   323 NWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 70/317 (22%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 69/309 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.