DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or24a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:426 Identity:80/426 - (18%)
Similarity:164/426 - (38%) Gaps:100/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YYYRIAFF----LGWTPPKGALLRWIYSLWTLTTMWL-----------GIVYLPLGLSLTYVKHF 75
            :|:.:..|    :|:.|.:...:  :..||:....::           ||.|:|:.::       
  Fly    15 HYFMVPKFALSLIGFYPEQKRTV--LVKLWSFFNFFILTYGCYAEAYYGIHYIPINIA------- 70

  Fly    76 DRFTPTEFLTSLQVDINC-IGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQRRIFHKMVAR 139
                     |:|  |..| :.:.|.|.|....:|.::  :||.|.:::....|.|::...|:..:
  Fly    71 ---------TAL--DALCPVASSILSLVKMVAIWWYQ--DELRSLIERVRFLTEQQKSKRKLGYK 122

  Fly   140 VNLIVILFLSTYL----GFCFLT------LFTSVFA---GK-----APWQLYNP----------- 175
            .....:....|:|    |||..|      |..::..   ||     .|:::..|           
  Fly   123 KRFYTLATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPI 187

  Fly   176 ---LVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRD------RIAN 231
               ||     ||..:|..:   |.|.        :|.:.:.|...|...|..|:|      .:.|
  Fly   188 TYILV-----HWHGYITVV---CFVG--------ADGFFLGFCLYFTVLLLCLQDDVCDLLEVEN 236

  Fly   232 LRQDPKLSEMEH---YEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFF 293
            :.:.|  ||.|.   ..:|...:..|..:.:.::.:..::.....|.|:...:.:|.:.:.||.|
  Fly   237 IEKSP--SEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLF 299

  Fly   294 PNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRA 358
            ...  .|:..|.:..|:..|.|..|:...|::|...:::.:.|.|:|.......:...|..:.||
  Fly   300 SGL--GIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARA 362

  Fly   359 QQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQM 394
            |:.:.... ..|..|:::..::.:|..::|.:...:
  Fly   363 QRVLTIKI-PFFSPSLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 69/347 (20%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 69/360 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.