DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or10a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:458 Identity:89/458 - (19%)
Similarity:164/458 - (35%) Gaps:133/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FFKRLQTAPLDQEVSSLDASDYYY----RIAF-FLGWTPPK-GALLRW-------IYSLWTLTTM 56
            |.||      ||::      |.|:    |::. .:|:.|.| |....|       |.::...|.:
  Fly     7 FLKR------DQQL------DVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATEL 59

  Fly    57 WLGIVYL-------------PLGLS-LTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSCVTYSQM 107
            ..|:.:|             |.|.| :|.:|.|       .:...:.|::.:.|.::. :.:...
  Fly    60 HAGMCFLDRQQITLALETLCPAGTSAVTLLKMF-------LMLRFRQDLSIMWNRLRG-LLFDPN 116

  Fly   108 WRFRRMNELISSLDKRCVTTTQRRIFHK-MVARVN--------------------LIVILFL-ST 150
            |......::              |:.|. |.||:|                    :.:||:| :.
  Fly   117 WERPEQRDI--------------RLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNR 167

  Fly   151 YLGFCFLTLFTSVFAGKAPWQLYN----PLVDWRKGHWQLWIA---------------SILEYCV 196
            |..|.:.|.|....    |..|.|    ||.       .::||               ...|:|.
  Fly   168 YEDFVWFTPFNMTM----PKVLLNYPFFPLT-------YIFIAYTGYVTIFMFGGCDGFYFEFCA 221

  Fly   197 VSIGTMQELMSDTYAIVFISLFRCHLAILRDRIANLRQDPKLSEMEHY---EQMVACIQDHRTII 258
            ......:.|.::     ..|:||.:...|           :||.::.|   ::|.:.|..|..||
  Fly   222 HLSALFEVLQAE-----IESMFRPYTDHL-----------ELSPVQLYILEQKMRSVIIRHNAII 270

  Fly   259 QCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEH 323
            ..::..|...:|...|.|:...:.:|.:.:::|...|.....|..|::.||..::....|.....
  Fly   271 DLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTL 335

  Fly   324 LIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTII 388
            :.|.|..:..|:|...|.......:..|...:.|:|:|:.. |...|..|:.:..|:.:.:.:||
  Fly   336 VAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSII 399

  Fly   389 TIV 391
            .:|
  Fly   400 ALV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 63/349 (18%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 69/375 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.