DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or9a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:448 Identity:87/448 - (19%)
Similarity:156/448 - (34%) Gaps:134/448 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQEVSSLDASDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMW-LGIVYLPLGLSLTYVKHFDRF 78
            :::..||......||......|:|.......|:    |..||. |.:..:|:.|:    .|    
  Fly    11 EEKDQSLRVQILVYRCMGIDLWSPTMANDRPWL----TFVTMGPLFLFMVPMFLA----AH---- 63

  Fly    79 TPTEFLTSLQVDINCIGNVIKSCVTYSQMWRF----------------------------RRMNE 115
               |::|.:.:..:.:|:...|.:|..:...|                            |.:.|
  Fly    64 ---EYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIE 125

  Fly   116 LISSLDKRCVTTTQRRIF------------------------------HKMVARVNLIVILFLST 150
            :.:..| :.::.|..|.|                              |..|...:|.|::|.  
  Fly   126 VENQSD-QMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFY-- 187

  Fly   151 YLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFI 215
                             .|..|:|.:..:.        |..:..||.|:     |...||.:  .
  Fly   188 -----------------VPTYLWNVMASYS--------AVTMALCVDSL-----LFFFTYNV--C 220

  Fly   216 SLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQII----RPILSITIFAQF 276
            ::|:    |.:.|:.:|   |.:...|..|.:|..:..|:..:|.:..|    ||:    ||.||
  Fly   221 AIFK----IAKHRMIHL---PAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPL----IFLQF 274

  Fly   277 MLVGIDLGLAAISIL-FFPN--TIWTIMANVSFIVAICTESFPCCMLC-EHLIEDSVHVSNALFH 337
            .|..:.:......:. .|||  :::.|....|.::|:...|     .| |::...|:...|.|:.
  Fly   275 FLSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIALFIYS-----KCGENIKSASLDFGNGLYE 334

  Fly   338 SNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQMN 395
            :||.......|.|:|....|||:|.|. .|..|..|:.:...:.:.|.:.|.::...|
  Fly   335 TNWTDFSPPTKRALLIAAMRAQRPCQM-KGYFFEASMATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 70/371 (19%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 68/364 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.