DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59c and Or82a

DIOPT Version :9

Sequence 1:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:340 Identity:66/340 - (19%)
Similarity:134/340 - (39%) Gaps:57/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CIGNVIKSCVT--------------YSQMWRFRRMNELISS--------LDKRCVTTTQRRIFHK 135
            |:..|..:.:|              :..:.|||:|:|..:|        ||              
  Fly    64 CLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLD-------------- 114

  Fly   136 MVARVNLIVILFLSTYLGFCFLT-----LFTSVFAGKAPWQ-----------LYNPLVDWRKGHW 184
            .||..|.:.......|...|.||     |...|..|...|.           :..|..|.....:
  Fly   115 YVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGY 179

  Fly   185 QLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVA 249
            ::.....:...||.:.....:  |...|.|....|.|...|:.:|.|. :.|. ||.:...::.:
  Fly   180 EVCFLYTVLVTVVVVAYASAV--DGLFISFAINLRAHFQTLQRQIENW-EFPS-SEPDTQIRLKS 240

  Fly   250 CIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTES 314
            .::.|..::..|:.:|.|.:.|:..||::..:.:|:....::...:::..::...||..:|..:.
  Fly   241 IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGSIMLQL 305

  Fly   315 FPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIA 379
            |..|...|.:..:|:.|..|:..|||..|....::::...:.::|:.:...|| .|..|:.:.:.
  Fly   306 FIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAG-FFVASLANFVG 369

  Fly   380 VAKFAFTIITIVNQM 394
            :.:.|.::||::..:
  Fly   370 ICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 63/329 (19%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 62/327 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.