DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or19a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:415 Identity:95/415 - (22%)
Similarity:165/415 - (39%) Gaps:76/415 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFW----TCVPFAFGVFY---LPVGFIISYVQE 72
            ||.|.:..:..:|...::|..||.:..      ||    |.....:.|.:   :.|.|.::.:|.
  Fly     5 KVDSTRALVNHWRIFRIMGIHPPGKRT------FWGRHYTAYSMVWNVTFHICIWVSFSVNLLQS 63

  Fly    73 FKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRK-------TEILLDSLDKRLANDSDRER 130
                      .||:........::..|:..|.|..:|:       :..||..|||||..|.:|:.
  Fly    64 ----------NSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQI 118

  Fly   131 IHNMVARCNYAF----------LIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLW 185
            |...:.|..:.|          ::...||...:....|.|     |.|..:|    |||...:..
  Fly   119 IMAGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLMY-----PTWIPWN----WRDSTSAYL 174

  Fly   186 IQAIFEYIT-MSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCV 249
            ..|:..... |:.|.|...|| :||..:.|:...|.:.|...|..|..............||..:
  Fly   175 ATAMLHTTALMANATLVLNLS-SYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYI 238

  Fly   250 LDHKTILKCCDMIRPMISRTIFVQ-------------FALIGSVLGLTLVNVFFFSNFWKGVASL 301
            .||:.||:....:...:|.|.|:|             |.|.|:|..:..:|:.|          |
  Fly   239 HDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLF----------L 293

  Fly   302 LFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGI 366
            |.::|  .:|...|||..:...:.:.|...::..||:.....::..|:|.:...|.|:|.::|.|
  Fly   294 LVILT--TETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVI 356

  Fly   367 FPISMNSNITVAKFAFSIITIVRQM 391
            .||||.:...:.|.|::::|::.::
  Fly   357 VPISMKTFTVMIKGAYTMLTLLNEI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 79/335 (24%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 79/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.