DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or98b

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:410 Identity:79/410 - (19%)
Similarity:135/410 - (32%) Gaps:118/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNFTPG--EFLTSLQVCINVYGASVKSTITYLFL 105
            ||.:....|:........|.:.|.:..||..:..|..  ..|..|.....:          .|||
  Fly    30 RYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKI----------GLFL 84

  Fly   106 WRLRKTEILLDSLDKRLANDS---------DRERIHNMVARCNYAFLIYSFIYCGYAG------S 155
            |..:..:.|:......|..::         .||...:......||   |.||..|.:.      |
  Fly    85 WLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQFISAMYA---YCFITAGLSACLMSPLS 146

  Fly   156 TFLSYALSGR-----PPWSVYNPFIDWRDGMGSLWIQAIFEYITMSFAV---------LQDQLSD 206
            ..:||..:|.     |..|||    .|.:...|.:|.:.|..:..:..|         |...||.
  Fly   147 MLISYQRTGELQPKFPFPSVY----PWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSH 207

  Fly   207 TYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVN-------CV-LDHKTILKCCDMIR 263
            ....:|.|.....|     |...      |:..:.:::|.:       |: |.|  .|.  :..|
  Fly   208 NLCALFQIARHKMM-----HFEG------RNTKETHENLKHVFQLYALCLNLGH--FLN--EYFR 257

  Fly   264 PMISRTIFVQFALIGSVLGLTL-VNV-----FFFSNFWKGVASLLFVITILLQTFPFCYTCNMLI 322
            |:|.:  ||..:|...||...| .|:     .|::.|...|..         |...:|:..:.:.
  Fly   258 PLICQ--FVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVG---------QVSIYCFCGSSIH 311

  Fly   323 DDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIA----------------GGIFPISM 371
            .:.|.....|::|:|              .|.:|:.:..::                |..|..:.
  Fly   312 SECQLFGQAIYESSW--------------PHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANR 362

  Fly   372 NSNITVAKFAFSIITIVRQM 391
            .:.||:.:.|.|.:|::|.:
  Fly   363 ETLITIVRTAISYVTLLRSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 68/365 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 68/369 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.