DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or98a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:391 Identity:166/391 - (42%)
Similarity:242/391 - (61%) Gaps:3/391 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIKPAPLTEKVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYV 70
            |.||.| |..:.|.....|....|:.:||..|  ...:.:|...:|:.||:...|||:|.|||:.
  Fly     6 LRKPNP-TNLLTSPDSFRYFEYGMFCMGWHTP--ATHKIIYYITSCLIFAWCAVYLPIGIIISFK 67

  Fly    71 QEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIHNMV 135
            .:...|||.|.||.:|:..|..|...|.....|::....|.:.||..:|||.....:|..:|..|
  Fly    68 TDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGV 132

  Fly   136 ARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEYITMSFAVL 200
            .|||.|:|||.|||..|..|||||.||||:.||.:||||:|:|:...|.|..|:.|...|.|||.
  Fly   133 VRCNKAYLIYQFIYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVT 197

  Fly   201 QDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIRPM 265
            |..:||.|||::.::.|.|:::|:..|.||..|..:|:|:|.|||:.|:.||..|:.....|||.
  Fly   198 QTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPA 262

  Fly   266 ISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSN 330
            ::|||||||.|||..|||:::|:.||::.|.|:|::.::..:::||||||:.|::|..|.:.|.:
  Fly   263 VTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVS 327

  Fly   331 EIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQMNLAE 395
            .||.|||:::...||::|..|:.:.|:.|.|.||.|||||..|||.|||.|||::|.|.|:|:|:
  Fly   328 AIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLNIAD 392

  Fly   396 Q 396
            :
  Fly   393 R 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 135/304 (44%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 135/304 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468548
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.