DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or94a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:406 Identity:90/406 - (22%)
Similarity:169/406 - (41%) Gaps:60/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EKVQSRQGNIYLYRAMWLIG---WIPPKE------GVLRYVYLFWTCVPFAF---GVFYLPVGFI 66
            ::::|.:   .:.:.|.|.|   |....|      |.::..|.|...:|..|   |:.:|. .||
  Fly     6 DRIESMR---LILQVMQLFGLWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLMWLE-AFI 66

  Fly    67 ISYVQEFKNFTPGEFL----TSLQVCINVYGASVKSTITYLFLWRLRKTEI------LLDSLDKR 121
            .|.:::     .|:.|    |.:.:.:.:           |.:|..| ||.      |..:.|.:
  Fly    67 SSNLEQ-----AGQVLYMSITEMALVVKI-----------LSIWHYR-TEAWRLMYELQHAPDYQ 114

  Fly   122 LANDSDRERIHNMVARCNYAFLIYSFIYCG--YAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSL 184
            |.|..:.:..........:.|.||..|..|  |:|.|.:.:......|::.|.|| :|::.. ..
  Fly   115 LHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPF-EWQNER-RY 177

  Fly   185 WIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNY---QDLV 246
            |....::...|:...:.:...||....|..    |:.:|. .:..||:...::..::.   |.|.
  Fly   178 WFAYGYDMAGMTLTCISNITLDTLGCYFLF----HISLLY-RLLGLRLRETKNMKNDTIFGQQLR 237

  Fly   247 NCVLDHKTI----LKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITI 307
            ...:.|:.|    |.|..::.|.|...|.:. |||....|..|.:|....|..:.::.|.||..:
  Fly   238 AIFIMHQRIRSLTLTCQRIVSPYILSQIILS-ALIICFSGYRLQHVGIRDNPGQFISMLQFVSVM 301

  Fly   308 LLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMN 372
            :||.:..||..|.:...|..|:||::.:||::..|..:..|..:|.|:::|:...||..|.:.:.
  Fly   302 ILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLP 366

  Fly   373 SNITVAKFAFSIITIV 388
            ..:.....|:|.:.::
  Fly   367 IFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 72/323 (22%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 72/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.