DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or92a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:373 Identity:77/373 - (20%)
Similarity:134/373 - (35%) Gaps:62/373 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FYLPVGFIISYVQEFKNFTPGEF---------------LTSLQVCINVYGASVKSTITYLFLWRL 108
            |||.:||:     .|..:..||.               .|::..||   |.|..:......|...
  Fly    51 FYLVLGFL-----NFNAYVVGEIAYFIVHIMSTTTLLEATAVAPCI---GFSFMADFKQFGLTVN 107

  Fly   109 RKTEI-LLDSLDKRLANDSDRERIHNMV---ARCNYAFLIYSFIYCGYAGS--------TFLSYA 161
            ||..: |||.|.:....|.:.:|.:|:.   ...|....:::.:...|..|        :.:.|.
  Fly   108 RKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKHMNRVMTLFTILCMTYTSSFSFYPAIKSTIKYY 172

  Fly   162 LSGRPPWS---------VYNPFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTI-MF 216
            |.|...:.         .|:...|......|.|..|...|:.....|..|.|     |:.|| ..
  Fly   173 LMGSEIFERNYGFHILFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVCVDLL-----LIATITQL 232

  Fly   217 RAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVL 281
            ..|...:.:.:.:.. ..:.::.:|.:.|.|.|:.|...|...:.:..:.|      |.::.:.:
  Fly   233 TMHFNFIANDLEAYE-GGDHTDEENIKYLHNLVVYHARALDLSEEVNNIFS------FLILWNFI 290

  Fly   282 GLTLVNVF-----FFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAE 341
            ..:||..|     ..||....|...:|....|:|.|..||..:.:|..:..:.:..|..||:...
  Fly   291 AASLVICFAGFQITASNVEDIVLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCS 355

  Fly   342 PRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVR 389
            .:||..|...:...|:|.........|||.|:.:.|...::....::|
  Fly   356 TKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 70/346 (20%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 68/330 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.