DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or85a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:397 Identity:147/397 - (37%)
Similarity:240/397 - (60%) Gaps:4/397 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFKLIKPAPLTEKVQSRQGNIYLYRAMWLIGW-IPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFI 66
            :||.|:...|....:||...|||.|::..:|| :||:.....::|..||.|.......::|.|.|
  Fly     2 IFKYIQEPVLGSLFRSRDSLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVVIVLVFIFIPYGLI 66

  Fly    67 ISYVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERI 131
            ::.::||||||..:..|.:||.:|...:.:|..|......|..:.:.::|::|.|.....::.::
  Fly    67 MTGIKEFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQV 131

  Fly   132 HNMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEYITMS 196
            |...|.||...:||..||.||.........:.|:.|:.:|||.::..|   ..::....|.:||:
  Fly   132 HRAAALCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPDD---HFYLATAIESVTMA 193

  Fly   197 FAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDM 261
            ..:|.:.:.|.||:::.::.|.|||:|.:.:::||.|.|:.:..:|.:||.||.|||.|::..:.
  Fly   194 GIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGNT 258

  Fly   262 IRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQ 326
            :|||||.|:|:|...:|.:|||..|::.|::...:.|.|.::.|.||.|||||||.|..|..|.:
  Fly   259 LRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDCE 323

  Fly   327 DLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQM 391
            .|:|.:|.|.|:.||.||:.|::.|:|:|||.|:|.|||||||.:|:||.:||||||::|||.:|
  Fly   324 SLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNEM 388

  Fly   392 NLAEQFQ 398
            :|||:.:
  Fly   389 DLAEKLR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 111/304 (37%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 111/304 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468551
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.