DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or83c

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:423 Identity:83/423 - (19%)
Similarity:156/423 - (36%) Gaps:84/423 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RQGNIYLYRAMWLIG--WIPPKEGVLRYVYLFWTCVPFA------FGVFYL-------PVGFIIS 68
            |:.:.|:.....|:|  ::.||   |::.|..||.: ||      |.||.:       .||...|
  Fly    12 RELSKYINSLTNLLGVDFLSPK---LKFNYRTWTTI-FAIANYTGFTVFTILNNGGDWRVGLKAS 72

  Fly    69 YVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIHN 133
            .:........|:|||.|     :....::..:.|        ::.:.|..:.|  .||....:::
  Fly    73 LMTGGLFHGLGKFLTCL-----LKHQDMRRLVLY--------SQSIYDEYETR--GDSYHRTLNS 122

  Fly   134 MVARCNYAFLI----YSFIYC----------GYAGS--TFLSYALSGRPPWSVYNPFIDWRDGMG 182
            .:.|......|    |.|.:|          .|.|:  |.:.|.:.|.|..:.|...:.:.....
  Fly   123 NIDRLLGIMKIIRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVTYMIQTV 187

  Fly   183 SLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRS-------LRMDPERSEAD 240
            ::.:|.:..|....|..    |..|..|.|..|.:..::.|.|.:..       :|:......|:
  Fly   188 TMLVQGVGFYSGDLFVF----LGLTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAE 248

  Fly   241 NYQDLVNCVLD-HKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFF----SNFWKGVAS 300
            |.|.|:..|:. |:.....|..|..:....|..|      ||.:.|..:..|    |:|  .:.|
  Fly   249 NRQRLLLDVIRWHQLFTDYCRAINALYYELIATQ------VLSMALAMMLSFCINLSSF--HMPS 305

  Fly   301 LLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQS----NWVDAEPRYKATLVLFMHHVQQPIIF 361
            .:|.:........:| ....:::.|.|   ::::|    .|.:.....:......:...|.|...
  Fly   306 AIFFVVSAYSMSIYC-ILGTILEFAYD---QVYESICNVTWYELSGEQRKLFGFLLRESQYPHNI 366

  Fly   362 IAGGIFPISMNSNITVAKFAFSIITIVRQMNLA 394
            ...|:..:|:.:.:.:.|..:|:..::  ||.|
  Fly   367 QILGVMSLSVRTALQIVKLIYSVSMMM--MNRA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 61/336 (18%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 62/348 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.