DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Orco

DIOPT Version :10

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524235.2 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:132 Identity:27/132 - (20%)
Similarity:51/132 - (38%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 HKTILKCCDMIRPMISRTIFVQFALIGSVLGLTL----------VNVFFFSNF-WKGVASLLFVI 305
            ||.:::....|.......:.:.  ::.|.:.|||          |||:.|:.. :.|.|      
  Fly   345 HKHVVRLVAAIGDTYGAALLLH--MLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYA------ 401

  Fly   306 TILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPIS 370
              |.|.|.||...|.||:::..:....:..:|.|.....|..:.:.....|:.:.......|.:|
  Fly   402 --LAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVS 464

  Fly   371 MN 372
            ::
  Fly   465 LD 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 27/132 (20%)
OrcoNP_524235.2 7tm_6 70..472 CDD:251636 27/132 (20%)

Return to query results.
Submit another query.