DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or83a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:458 Identity:100/458 - (21%)
Similarity:179/458 - (39%) Gaps:130/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YVYLFWT-CV----PFAF-----GVFYLPVGFI-ISYVQEFKNFTPGEFLTSLQVC---INVYGA 94
            :|::..| |:    ||.:     ||..:.|.|. ::|  |..|:.....:..|.:|   || ||.
  Fly    20 FVFVRQTMCIAAMYPFGYYVNGSGVLAVLVRFCDLTY--ELFNYFVSVHIAGLYICTIYIN-YGQ 81

  Fly    95 S-----VKSTI-TYLFLWRL-------RKTEILLDSLDKRLANDSDRERIHNMVARCNYAFL--- 143
            .     |...| |.::||.:       |....||:::   |:|.:|.....:.|   .::|:   
  Fly    82 GDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGLLNTI---LSNINDEYETRSAV---GFSFVTMA 140

  Fly   144 ---------IYSFIYCGYAGSTF---LSYALSGRP-PWSVYNPFIDWRDG----------MGSLW 185
                     |.:::||.|.|:.|   |..|...|. |.:.:.||...:.|          ||.:.
  Fly   141 GSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQ 205

  Fly   186 IQAIFEYITMSFAVLQDQLSDTYPLMFT----------IMFRAHMEVLKDHVRSLRMDPERSEAD 240
            :.|.|...:....||...:|..|.::|.          ::..|:|..|.      ::..|:|.||
  Fly   206 VAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELN------QLQAEQSAAD 264

  Fly   241 ----NY----------QDL-----------------VNCVLDHKTILKCCDMIRPMISRTIFVQF 274
                .|          |:|                 |.|:..|:.|:.....|....|...||: 
  Fly   265 VEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVK- 328

  Fly   275 ALIGSVLGLTLVNVFF------FSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIF 333
              ||.|..|..:..|.      .::|.:.|:...:::.:|.:.|..||..:::..::|.....::
  Fly   329 --IGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALW 391

  Fly   334 QSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKF------AFSIITIVRQMN 392
            :|.|.......::..:.||.:.::.....||.|      ||:.|.:|      |||.:|::::|:
  Fly   392 RSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKI------SNLNVDRFRGTITTAFSFLTLLQKMD 450

  Fly   393 LAE 395
            ..|
  Fly   451 ARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 82/399 (21%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 62/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.